PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG609300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bHLH
Protein Properties Length: 93aa    MW: 10350.7 Da    PI: 7.3653
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG609300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH23.97.3e-0820591554
                         HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                  HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                         +i +  ++L++llP+a  +++ ++  a +L+++++YI+sL
  Pavir.9KG609300.1.p 20 QISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRSL 59
                         789999*********889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.101.2E-8379IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.683559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474595.63E-91981IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.9E-52059IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRSRSRQ SGSSRITEEQ ISDLVSKLQD LLPEARLQSN ARVPSARVLQ ETCNYIRSLH  60
QEMDDLSERL SELLATSDMS SAQAAIIRSL LM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.163441e-157root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985540.15e-57PREDICTED: transcription factor ILI6
SwissprotB8APB51e-45ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR21e-45ILI6_ORYSJ; Transcription factor ILI6
TrEMBLK4AH746e-57K4AH74_SETIT; Uncharacterized protein
STRINGSi038231m2e-56(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.15e-31bHLH family protein